Message boards : Cafe Rosetta : discussion
Author | Message |
---|---|
NewInCasp![]() Send message Joined: 12 May 06 Posts: 21 Credit: 5,229 RAC: 0 |
Is it possible to discuss casp targets from sequence information only. |
![]() ![]() Send message Joined: 30 Dec 05 Posts: 1755 Credit: 4,690,520 RAC: 0 |
Is it possible to discuss casp targets from sequence information only. Not sure what you wanted to discuss. My understanding is that the sequence information is what CASP gives you, and you are supposed to give them back a 3D model of it. From there, for discussion it would be simpler to refer to it as "CASP7 target 1" rather then "MSFIEKMIGSLNDKREWKAMEARAKALPKEYHHAYKAIQKYMWTSGGPTDWQDTKRIFGG ILDLFEEGAAEGKKVTDLTGEDVAAFCDELMKDTKTWMDKYRTKLNDSIGRD" Dr. Baker shows the above sequence is the first CASP target in his journal. Add this signature to your EMail: Running Microsoft's "System Idle Process" will never help cure cancer, AIDS nor Alzheimer's. But running Rosetta@home just might! https://boinc.bakerlab.org/rosetta/ |
Message boards :
Cafe Rosetta :
discussion
©2025 University of Washington
https://www.bakerlab.org